TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A7HRC0|A7HRC0_PARL1 Uncharacterized protein OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=Plav_0830 PE=4 SV=1
MPLWIPLTIAAAFLQNLRSTLQKQLTGEMSALGATYVRFAYGLPVAALYLWGLLAFTGAAMPEANASFLAYATVGGLAQI
WGTVLLVALFAYRNFAVGTTYSKTETIQTALFGIIVLGDHLSFGAFAAILISLAGVLAISIAQSKLTLGTFWRSLGEKPT
LMGIGSGACYGVAAVCYRAASLSLERPDFLVSAAYTLVIVLLIQTAVMTVWLRLRHPAELSASFRTWKVSSLVGVTGALA
SMGWFTAMTIQNAAYVRALGQIELVFTFASSHFLFREKTNALELTGIALVIGGILLLIFAR