TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A7UST9|A7UST9_ANOGA Gustatory receptor OS=Anopheles gambiae OX=7165 GN=GPRGR53 PE=3 SV=2
MQPIKSFYLFSKLFGLCPYPLDPTVPVNTRASYVKQLLPTYTVLLLYSSCLVSIFWQSGNTSDISNAANWIQFIPNSFAY
VFSLVFAIRHRTMANEILTTFAIADDKLRTQFGISFTMPNVKMRRVSILACIVTMTCGSTIGALTYLIGVNWNRIWTLLY
WIAFCMPKFAGCILYLSDRAMLLLRGMNNFPVGVENLALQPQTHGHGPQYKTLNMAMGGNHLPSMHEGKLNRLTTLATIK
IRAISPLDSIQHIREVVELLQDLSVKINHCFGKQAIFSLLSAFTCVTVQLYYMLNHIKSGFTASRSEIYALASCSLLFLH
GIEFWSLFTSGENVRLKWKKVINFLFFMKSKSADDDFRTKVDDLISFMVTNPLEFNAYGLFPIDLSVLTGIASSITTYLI
VLIQFKISEEQSSGYDDDSDEKSQIQYSAH