TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A7XXR3|A7XXR3_9CAUD Portal protein OS=Thermus virus P74-26 OX=466052 GN=P74p85 PE=1 SV=1
MAKRGRKPKELVPGPGSIDPSDVPKLEGASVPVMSTSYDVVVDREFDELLQGKDGLLVYHKMLSDGTVKNALNYIFGRIR
SAKWYVEPASTDPEDIAIAAFIHAQLGIDDASVGKYPFGRLFAIYENAYIYGMAAGEIVLTLGADGKLILDKIVPIHPFN
IDEVLYDEEGGPKALKLSGEVKGGSQFVSGLEIPIWKTVVFLHNDDGSFTGQSALRAAVPHWLAKRALILLINHGLERFM
IGVPTLTIPKSVRQGTKQWEAAKEIVKNFVQKPRHGIILPDDWKFDTVDLKSAMPDAIPYLTYHDAGIARALGIDFNTVQ
LNMGVQAINIGEFVSLTQQTIISLQREFASAVNLYLIPKLVLPNWPSATRFPRLTFEMEERNDFSAAANLMGMLINAVKD
SEDIPTELKALIDALPSKMRRALGVVDEVREAVRQPADSRYLYTRRRR