TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A7ZFA1|A7ZFA1_CAMC1 CvpA family protein OS=Campylobacter concisus (strain 13826) GN=cvpA PE=4 SV=1
MMDLVTWFDIIVIALVLILGVKGIINGLIKETFGLIGLIGGLVVASRFSDVAESFISKNIYKFENPSFLQFVAFIGLWLV
FWLVCLLVGKFLSKIVSVSGLGFLDRLGGFVMGSGKIFLTFSAVVAVMSGTSLNKMIEPYFTNSKVYPLLLGTGRWITNI
DVKNIKNELDEMVVRPKDTNKTDTFISMDANASTNTDTNVTKGEEK