TCDB is operated by the Saier Lab Bioinformatics Group
A8BIM9|A8BIM9_GIALA Putative uncharacterized protein - Giardia lamblia ATCC 50803.
MAEIPEADVTNSTSNDYPHTDLKEESDKCNTRSDAPRAGSFNALLFLQVLLGILCAFKPAEPFVVPYYIDNGISMDQINQ
TVFPMSGYSNFGFLLVLSMASIGISHHALLYFGWVGYVVCYTLLIFVDKLIVAIFAEVFYGLAVASETVYCATFYFLKNR
TVSVMTSHLRASTISRTTLLVTHVISDLFGQLMVSFITNFSKRLLFIITAISVSSSVVPLTILTCIQRHTPTSYFKVSKN
QVSDETSENGKNNDLCASSIGTEKMSRKLYLRGLSYVWGGGLAGVLPLYIGIFSLSGHTLYQNYITNILYDVQQGTKDEL
YGLFVMIGRLSGVLGSVLALTCKKVKRTGILQILLLFILSCLLIIPAFVKHLIWLFVANVVEFAAAELTITVMWAQLAAS
CQLSVYPAVFLCQALIVAAIVLIVQATVFNSVANEFEGFTANQTHYLWCAVLGLTGLLISLLVALVSRFRGSCRRGSKDN
ATKEDFDANPLLPDQSCEV