TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A8ESJ6|A8ESJ6_ARCB4 Colicin V production protein OS=Arcobacter butzleri (strain RM4018) GN=Abu_0655 PE=4 SV=1
MQNIAIFDLVIITITLLLGLKGLFRGIIKEIFGIIGIIGAIFVASRISTQTGELIAPVLVLENQATIKLIGFVIALVIVW
LIAYSAGVVVSKIFSASGLGIIDRFFGFLFGMAKIFLIFSVIAYALYQVNSFKKVIDEQFKTSILMPYLLDVGSVIIKLD
TTALTNNIDKAIETVTDTPSTIQNTTQEIKQEVDSTLNNVQEVVEDGVKDAVEEEVKTTKDKLKDIANKNENNQ