TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A8IT08|A8IT08_CHLRE Low-CO2-inducible chloroplast envelope protein OS=Chlamydomonas reinhardtii GN=CCP1 PE=3 SV=1
MSSDAMTINESLMEVEHTPAVHKRILDILPGISGGVARVMIGQPFDTIKVRLQVLGQGTALAAKLPPSEVYKDSMDCIRK
MIKSEGPLSFYKGTVAPLVGNMVLLGIHFPVFSAVRKQLEGDDHYSNFSHANVLLSGAAAGAAGSLISAPVELVRTKMQM
QRRAALAGTVAAGAAASAGAEEFYKGSLDCFKQVMSKHGIKGLYRGFTSTILRDMQGYAWFFLGYEATVNHFLQNAGPGV
HTKADLNYLQVMAAGVVAGFGLWGSMFPIDTIKSKLQADSFAKPQYSSTMDCLKKVLASEGQAGLWRGFSAAMYRAIPVN
AGIFLAVEGTRQGIKWYEENVEHIYGGVIGPATPTAAQ