TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A8KZL1|A8KZL1_FRASN Putative uncharacterized protein OS=Frankia sp. (strain EAN1pec) GN=Franean1_6654 PE=4 SV=1
MNTALVLGLPTTIVSAALYGVAPLLQAMAARREEAGTGLGLGLLARLATRPLWLIGLGVEAGSFLLEVYALSVAPVALVA
PVMALDMIVFTLLARRALGEQISRVGWSGVGLMVAGVGLLAYAFHRNAEVGSPAGNGVLLAFLVLGLIFSLLCAFGANLA
AAKRQVAGAALGFGLAAGVSYAIATLATRQIGLAVHERRNSDSTLIDLLSTPTPYVLILFSVLALGLEQRGLQGRAAVIA
FPVTSGVSAFLPVTLGLTLFDEPAPDGPRLLAFIVSLVMVAAGIGALGRDRMAANRSVEDEPAVDPRAGCGPADEDDYRP
LDGATDQDDWAVPGTGAGYDRGGTAPGGAPAHGSADRFGVVMDPLRSAQS