TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A9B095|A9B095_HERA2 Colicin V production protein OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=Haur_2566 PE=4 SV=1
MRLTILDWVLIGILLWYSVLGFYWGTIRQLLALAGLITAIAIAGRIYPGVTDLLISLIPATAPGFISVFAFLLSLLAVTA
LVSAIATWLRLKVGLLFLGRADHVIGALLGLVQGIVLIGACLAGCVGLPQIGIIDAIQQSSLAEYWGPVVLVIVNLLPET
FVPMNQMLFG