TCDB is operated by the Saier Lab Bioinformatics Group
>AEA30101.1 hypothetical protein [Callinectes sapidus reovirus]
MKSQTGSRGFSARYDLCQLICVILATVGGMSQVMSIILSGYVPADYRETCEYVGHTLAILCFAIQIGLMRWMRSDKVAIG
VVMDKMSRSLSAVGVVGDQDVISKQGSKLNDSGYLNLLGMAQSHFDGIEHHQPKAEDTXSLLGDENVESLVKLNGQFVMM
MSGTGTTLPLRLMSDFVKAVFTTEFKNDDATFVVKEDTVLPMSLMNHPMTGAVVEKYNPFYIYVTWGVRADGTWYVAKGT
AIPMPSYVKDWALKRSAAGRPHFAFKNAPWINDTVSITTEPKTNKTPVVMVPSSVYSLYPNIHKDEVVVPDAPPPYPVAA
SPV