TCDB is operated by the Saier Lab Bioinformatics Group
>AHI04209.1 hypothetical protein CFAL_01660 [Corynebacterium falsenii DSM 44353]
MDIFTYAADAAEGAATTADATGSSAETFFTFMNDFGSWVGVIAKLIGLIPNALQALGL