TCDB is operated by the Saier Lab Bioinformatics Group
>AKM77858.1 hypothetical protein UX70_C0001G0121 [Candidatus Wolfebacteria bacterium GW2011_GWB1_47_1]
MFNLFKKNQEEISRTTPGYEETERRTPKTGIILLILMFIAGIYFGLYAMDDLSNIPDRPKALSSCSYRYQTNTAGERPYE
NKLPTYYEEDLVRSLAYEDSNNCAIRLSPLEEAGGVAALYQRRITIEQQIDPVVTEYIQLDNNLQSIRSQIERATGEYGV
GLQEKQAEIDKPIFPTTPSQQSIVQLRQREAPLVSRLNQLRMQVDAFRPAFDAIDKDLTTAYKPVFKAHERAMRWYEFKV
FLLQFLLIIPFFFLALRKYLELHRKNSPYTVIITTIVAVLGLLLLKTVLFWFWGLFLAEILRVLIEWFGKYNILRSLLFY
FGMFLSFAIFGGAVYFLQKKIFDPRRVIIRRFRAKECPQCQTNLDLAAMYCPNCGAHTRAVCAHCGKDRFVGLPFCPHCG
DHTEAQ