TCDB is operated by the Saier Lab Bioinformatics Group
>AKM79430.1 hypothetical protein UY43_C0001G0713 [Candidatus Beckwithbacteria bacterium GW2011_GWC1_49_16]
MKGSILGFVVLEAGTTLLMKQLLNLAIHPYFVVLVSGLAASALMAVAFWRQPSFKKELLNLKVIKSIWPTAVFITLGNLF
GFAALKLTRATNYILLARTSVLLSPILAWLILREKVNHKIWPLVASVLLGIWLLTGDWRLIFNLSGDSLAALTALTISLD
FIWQKRAMIKVPLELMAFWRRLLSAILVGGIWLVTPQLGQTSFHFTGLGGMALGFAGMSFFMARALKVQAVAEFNLLINL
SPVLVGLSAYFLFGERLSGGQLVGAAFIIGSLVTFNLIKKQESLKLKAKR