TCDB is operated by the Saier Lab Bioinformatics Group
>AKM80287.1 type IV pilus biogenesis protein, type IV pilus assembly protein PilE [Candidatus Saccharibacteria bacterium GW2011_GWC2_44_17]
MTTQVKRTTYGFTIIELITVITIIGILAAIGTVSYSGYQKRAAKSDVVSTAQQVKLKLGEYFTDKNNYPENKAAVVAYIG
GVGSQLGDAFNLTKNSQSIQYAPTPSGCGSPTSPRCTSYTITIPGPYWGGASTENEVIRP