TCDB is operated by the Saier Lab Bioinformatics Group
>AKM80378.1 Type II secretion system protein [Candidatus Saccharibacteria bacterium GW2011_GWC2_44_17]
MPKFKYVATSNNDSSKTVTGTLDAPDEAAVVAALKKQRIQPLRVTIDGSRSSSFGKLFGGGKVKSDDLVIFTRQLSAMVG
AGVPLLRALNSLEQHAESPALKSILVAVIKDVEGGAPLADALEKHPNTFSDVYINMVRAGEAAGILDDILKRLALQQEKN
ASIRKKVKSAMAYPMVLMVITVIAFFGLMLFVIPQIGKILLDLGGPDAELPLLTKIMLGISAFSLQWWYILIPAIVGGVF
LVLRYIKTPIGKRHFHRLVLKVPAVNTIIKKVVIARFARTFSSLNGAGVSILETLTVTSRALGNVIYEDALLEAIEKVKN
GQQLSQVLEQDDLFPAIVPQMLAVGEETGQTDVVLLKVADFFEEEVDTSINSLSSIIEPVMIVIMGSAVGLIAASVMGPI
ASLSQNIKG