TCDB is operated by the Saier Lab Bioinformatics Group
>AKM80623.1 putative General secretion pathway protein GspG [Candidatus Saccharibacteria bacterium GW2011_GWC2_44_17]
MLNKSTESSTNTFTTKSGFTIVELLIVIVVIGILAAITIVAFNGVQNRANDTTVSTDLSNARKKLELTKVDLGHYPRSLA
EFPSFKITRSAYDTKLNNIYYITDTVNDLYALGVRSKTGKGFILTNTNLQEGVAVNGTATATAIGVTWGVPGTYAVLGLD
TATIGWHATWPWVQVN