TCDB is operated by the Saier Lab Bioinformatics Group
>AKM80661.1 pilin domain-containing protein [Candidatus Saccharibacteria bacterium GW2011_GWC2_44_17]
MSRSASGFTIIELLIVIVVIGILAAITIVAFNGVQNRAYNTAIQSDLKNFKTKVEVYKIDNNDQYPDATQLPVLKFKASQ
AAYSAAPTDQSNLYYCYSATDRSIFGLVAKSKSGSGYSITNSTGVQPYTGAYANPCTGLSASLTNNYRGYATDDVTDGPW
RTWAR