TCDB is operated by the Saier Lab Bioinformatics Group
>AKM80716.1 Type IV pilus assembly protein [Candidatus Saccharibacteria bacterium GW2011_GWC2_44_17]
MAIIKGVGDFFGLDIGTTAVRAVQLSNNGNGRWTLKHYGYAPLDAKTAEASSVEARHRLGEVIMTVVGQSGIKTKNVAVS
LAANKTFVTVVDLPKVSDAELKSTIKYQIDEYIPMSIDEAKVDWSLLGQSLHDPSKQEVLLASVTEQYAEETLDFVEGLG
FDVVASEPESLAMIRSVRDPAAKNAQVIVDIGESSTNVAVVYGDQPRLVRTIPNGLSTLVRAAVQNLSIQDDQARQFILK
FGLSRDKLEGQVVIALDSTLEGFVSEINKSIKFFQTRCPSIPVGDILVSGYASTIPGLPEYVGQKTSIPTALADPWRHVN
VPAGDQKLAAIRSEFTTAVGLAQRSGKA