TCDB is operated by the Saier Lab Bioinformatics Group
>AKM80720.1 putative type II secretion system protein E [Candidatus Saccharibacteria bacterium GW2011_GWC2_44_17]
MAFLTTEIQDKLTALFIDEGLVASEVLEAARAESASSKEPLFALLTQKHIIDDEMLAHAIAQVSGVPYVNLTNSVISQQV
LDLLPEDVAERFMAVPLAEMQNRLAVAMVDASNVQAVDYLASRIDKPLKVFMASEEGVRHILDQYRTDLSTIDAAAEVSQ
QEAAVEENNNIKTIVQDSPISRALSTILEYAVKSRASDIHIEPLEGALKIRCRVDGVLREIMQLPKTIEPALVSRIKILS
NLKIDEHRVPQDGQFAVKIANKEVDLRIAISPVVWGEQVVIRLLDKSGASFDLEDMGYAGRALRAIRKGVKRPNGMVLTS
GPTGSGKSTSLYALIKEIKDDSVNIVTLEDPVEYKMSGVNQIQVNGEVGLTFANGLRSILRQDPDVVMVGEIRDDETASL
AVQAALTGHLVFSTLHTNSAAGVLPRLLDMHIEPFLIASTVNTIIGQRLVRRVSQKRDSYQSSPLETQNILATVGHLLPK
TPAEVVQVSQDLGYKDLPLAGQNAYTLVKGKDTPATPRGYNGRAGLYEVMDVTEEIQQLIVTRSTTTAIQKVAVAQGMIT
MRQDGYLKALQGITTLEEVNRVTADTL