TCDB is operated by the Saier Lab Bioinformatics Group
>AKM80757.1 membrane protein of unknown function [Candidatus Saccharibacteria bacterium GW2011_GWC2_44_17]
MPGVADRSLVRAPNNIFTAADLCYQNIYGLLLWLFFLLIGIVKSMLGKFLVAAALISGILVGLILTTTTPTSAGAIGILG
IFVLSYIFLVSLLTFFIFGFSRFLSRFFVIFSKNTQATPVPLKKSYYYSSVIALAPVIILSMQSVNGVGGYEFGLICLLV
VLGCLYVAKRVE