TCDB is operated by the Saier Lab Bioinformatics Group
>AKM80781.1 hypothetical protein UW38_C0001G0951 [Candidatus Saccharibacteria bacterium GW2011_GWC2_44_17]
MHYFEVAPTAIIRTGSDTFTYASQSPLPIGQLVVIEVGKKQLTGIITSATKKPSYETKSILSTIETAPLPTELIKLAFWL
KEYYNSPLATVLQTLLPRGLQKNRRDRLSTHRESLRDRTTIVLTKDQHDAVQAVESMTPGSALVHGVTGSGKTHIYIELA
KHTLARNQSVIILVPEIALTSQVVDEFSHHFENIILVHSRQTEAERHLAWQDALNSKSPRVVIGPRSALFTPLHHLGLIV
IDEAHEPSFKQEQSPRYSALRAASVLTRLHDAKLILGSATPLVTDYYLAAQSDRPIITLPERAKKDATPPTITLVDMTKK
ASFTHHRFLSNTLLSELEASFSRGDQVLIFHNRRGSASTTLCENCGWSATCPQCFIPLTLHADAHHLRCHLCGRNEKVPT
SCPTCHSADIIHKGIGTKLIESELRKRYPHKVIVRFDGDNESGDTVESRYNDLYSGAIDIIIGTQVIAKGLDLPKLRLVG
VIQADAGLALPDYTSSERTFQLLAQVVGRVGRSHHPTTVVVQSYQPNHLAVTTGLAQNYEQFYETTIDERRRANFPPFTY
LLKLTCIYKTEIAAIKNAKKLATELRAACPQSVQILGPTPSFYERQRDTYRWQLVLKSPRRADLVAALALVPPTHWQSEL
DPMSLL