TCDB is operated by the Saier Lab Bioinformatics Group
>ANY92101.1 CD4-like protein 2 [Ctenopharyngodon idella]
MPACKILFFLLALFISCGQCNELKYGQVGGEVSMDCGVSQNSDVEWKLDNILIMKIDGKTGTSRKGPSHIRNRANVSGGK
LKVSRLETGDAGVYSCSQTGKRYTLHIVSVSVFAKPGPVLVQSSSAELHCDITGHPNTEVQWMSPSNDKKDDKKQVIHLK
SVTSKDDGQWTCLIKDDLKFSLKLTVVAGLQTTAVEVSEGGKIVLPCSLPQRVSQPVVGGKWTADHLPTVSFPTLKNTET
KGLHWSGENSSKVTFTSEQLNIKYDVTLINAQRSDEGQYVCTVEFEGGVKLTAEMNLTVVTDAKPSGGKEVIKKKGKTPT
GGGLWKNEVFGLQLWIWIAVGASSVVLIVLIIVTVLVRQRNKRMKKRVKKLRSMRQPLTAKDYCRCRAESEVELVEQERP
LPVPRQQHNPRTRTAGSNHTIEKSRVQDY