TCDB is operated by the Saier Lab Bioinformatics Group
>AOZ21512.1 putative agglutinin protein [Triticum aestivum]
MFPLSALPRCVALRSKHGNSYLRSVHDKSQGGNFVELSADNDGGVMNPRCRFYLEASKEHDGLVHVRCCYNNKYWAPQQR
LLHGSARWTIGTANELEEDLSKPSCTLFKHIPVSGEDGSTCRFLHSQLGKYACVLSSSDMSKHPYLHIAREESDQDNLLD
AFTVLDVSEQMQLPSYLAFKGDNGRFLGAKIVEGYRYLEYSKDDIGDLSVLHTIFTNKDGVVRIKSNYFDMFWRRSPNWI
WADSTDTTHNNRDTLFKVTTGPDFIALRNLGNNNFCKRLTTEGKYDCLNAAVGSITAEVKMRCIEPIVSRDIYDVDFRLG
EAKIYTNGIEGLDSQIVENMTTTTNKTKMIFTYTNTVQSTWSSTVSLKIGVKTKFKSGIPFVVDGEVEVSTEFSGSYTWG
GAKSDTKVVSKQIDVEVPPMKKVTVKAIGSNGLCDIPFSYKQRDILTNGDEVIQEFTDGMYFGVKTSSITFHTKEEHL