TCDB is operated by the Saier Lab Bioinformatics Group
>ASJ79155.1 structural protein [Curvibacter phage P26059A]
MAITKQNQTTAQSAQAVEKAVAPLDKPERFQLGSVGYSGLQLFNGVSNEEMKQELNFPRSVYTYKEMSYHSAINSCLSLY
DNLISKVDWRVIPPKDATDEEKKQTEFINECLGDMDHSFRDFIKDALSSNIYGFSVHEKVFRKRTKANGSLYDDGKIALK
KLALRHQESITKFIYDREGNEILGVEQNTSSVNSMRYASSAQKNRVVLPKSKFVHITVGRNRGDPFGKSPLRDVYLAWRY
LTVIQEIEAAGVARDLQGLPVLEIPAQYMSADASPEQKAIYENFKNIIRNIQNNSQSGIILPSAHDPETRTKLFSLTLLN
SDGKKSFDTGKVKEFYQNQIYTGLFGDVLVLGQGGVGSFALGQIKNSLTGSYVESMLDGLVETFNRDVIRQLYELNGFNP
ARACSLDYENLHTIDMETVSKFWQRVASTGMVEKDRAVLNAVRTAAGLDALPDDLPPQDDLLTDSTTRAGDGFATAGEGT
STSVTGADSSSLNQDNAA