TCDB is operated by the Saier Lab Bioinformatics Group
>AUR95278.1 coil containing protein [Vibrio phage 1.205.O._10N.222.51.A7]
MKKFSTRELSDLMGDIDAQPDWRTPANKCCQYYDSEQLPPDVKARLQDMGQPELVFNLIKPVVNGVLGMEARTRSDLIIT
ADDPNEEIEDMVNALNEQYKDVRRLCDAEIAESDAYASMIKAGVGWMELYRNPYPMQSPYKMHFVHRDEIYWDSNCKQRD
LSDCRWLLRRRWIDYDEAYTMFPDKKDILKRSINNDWDSFIGDVSTQAIEGNNPGYESAWAEYQKFTRKETEWLQPKRKR
VLLQCVYYSVFEQKVFLEFENGRVEEYDNTNRIQNAFVATGKATVRVAPVRSIREAWFVGPTKVRDVPCKAPHGWFPLVP
LWGYRRDANNMPYGMIADMISPQDSVNFRYIKLTAALNHKTVIMDEDATNLNDRQVKEQVNSVDGLIKLNSNRRNKKTID
EAFQIRPNADISSQQFQLALDSRQLIEQTAGVYSAMLGDGKSGQSGVAINNLIEQGATTLAEINDNYRYGRLMLGRLLML
YLFEDMKKKKNIKVTVFKEDKSKRKQVVLNAEVSGEPKLTNDITKLRSHVALAPIQQTPTFRAQMAQQLTQVTQNLPPEV
QMSVIDMILELMDIPNKSEYLDRVRGALGINKPAEQMTPEEQQAAQAQAQAAQAAQEMQQRAMNAEVTGKEADAANKQAE
ALRKQREIQSMDVNDGKTQAETAKALSEVEAADQETIRNNAAMLQQMSAALDQVAL