TCDB is operated by the Saier Lab Bioinformatics Group
>AXF48184.1 arginine-vasopressin-like peptide [Laodelphax striatellus]
MASVGLMLFYVVGLVAGCLITNCPRGGKRGLHSYMKKLAEEKMALANEVPLQCARCGAEGEGYCVGPSICCGPQLGCLFA
SQSIQNQCSGSVLPHSQNAPSCFMPDGYGVCSTDGVCCNTESCRIDPTCEVDPDHNVCNVWTESKNIAL