TCDB is operated by the Saier Lab Bioinformatics Group
>AXH46464.1 portal protein [Gordonia phage RobinSparkles]
MSVLLGPNGQPISSDYAKTKVKSSKKPKVGEIGGWSNLSLMKAQLLPANNHLQFDTSKLRLSDYRMMRDHYQVNSSLSLL
TFMIHQVDFTVQCEDKKAAQHCEDNLRKIWTRLVRAMSISFWSGYSPNALQWENDDVAGKVMLTKIKDMLPEECSPRWKK
IPAVGGTRIGLDDQLEVQNANSIRGRRTAKIFDGIKQAGYEDIPVENSFWYPLLQETGNMYGKKLLNAVFQPWFFSLLVH
VFANRYYERFGEPAILARAPFDDEVTINNTKVKGNQLMQHVGSLMRSGAIGVLPNDKIQSGMENDSDYEYTLEYLESQMR
GADFERYMSRLDQEISLGLFTPVLMTQTGDGGSFNLGVTHTQMYFRQINAVLADMKEYIDRYILYPMALYNFGDKVKPPE
IKFRKLGATDPETIRGIITGLISGKNVTFDEIELGQELGLTIEKIEEIKEPLDVPDPNDNPDDNSAPSNKQTDPRIGKGR
PERTQRPKGVDKKTKVAAGLADRIAQQYESGRDKPDTGFKARYADWFNTDLCGGFTNPGDSNRYYRELTQEVEAAFDNAK
AIEIGDDAGVFFKEVITSHMDRLEHDYAG