TCDB is operated by the Saier Lab Bioinformatics Group
>AXH81214.1 PB1-F2 protein [Influenza A virus]
MEQGQGTLWTQSTEHTNTQRGGGGQQIQKLGRPSSTQLMDHYLRIMNQVDMHKQTVS