TCDB is operated by the Saier Lab Bioinformatics Group
>AYD81498.1 portal protein [Arthrobacter phage KBurrousTX]
MVKTTVPTNAIGHPGGYKPVWRPGANNIFEVDPFEPTPELVWPYNVMVYDQMRRTDGQVGGTLRAMTLPILSANWDFETE
GVRPEVVELCRTELGIQKPGESRRRRRRQGINWLDHCRMALQSVYFGHMPFEQVYEVGPPAPGQENIDLETVIHLRKLDP
RPPRTLTEIRVAADGGLAGISQPPIELTPGVYKERFIPVDQLVMYCMDREGADWTGNSILRTVYKNWLIKDILIRSSAQI
VERNGMGVPVMSYDENTEGASRAEAERVVQEFRAGASAGVVKPVGTTFELVGVNGSTVDPLPVINYHDQAIAKGALAMFM
DLGHDAGARSLGDTFVDFFTQSLQAVADQIADTATEHVVRDLVEWNYGPDEPYPLITPGELKNNQNVTATTLSTLVNAGI
ITPDGKLEKHVRTSLNLPDSDPATARPKDAPAPAPNEAGTVLPLSEGVSNLDKMAYYSQRFLDLQQRHGHGS