TCDB is operated by the Saier Lab Bioinformatics Group
>AZB50151.1 polymeric immunoglobulin receptor-like protein [Penaeus japonicus]
MCECSFVRVACVALALAAASLAQEYSVDEPNNRDVVFNGVQSSDVSLIFDDADIIVNPGERLDLNCGFQGQYRHCIWELE
GAKPIQVQDVYDDVHPGMSRPEVSEGNECGIVINSVSTEQHGKWTCRVFITGNSLEGSKKVIVTVKPTYPILEVDNSQLL
EVTSDAETPVKCVVAAARPAVGIRWFLGDKDVTVMAETEETPTDNEGMYKSISTLRRTFEPMENGMMLVCSVSHKTLTVP
ENASIPLNVVFKPVEKPVSTYYQIRPGSDYEVKLNFSANPPPTRKEWRYGDTFQNIAVSIEIPGAKDRYETYIEELGNGM
YTATLRIAGFKEEDANQRYMLVVQNDLGETSYKVRLSMDDAPKDGDSETRDHDKNPSTEYSVSEGIVFDDDTMSNTLSGG
AVAGIVIVVLIIVTAVAAAGYARYRQMFCFAPVVTPDPEEGKETKEEHSDTESARGANTTRAANLKNSLGRLTQVFKKPK
KEQETKLENIGDDEKRSLTTEDPKKGSPIKEQNVDDKEVVYAELDLGKSESDKKTEVKAEDKTEYAQIVGTVTDNREDEK
KE