TCDB is operated by the Saier Lab Bioinformatics Group
>AZF88291.1 DUF935 family protein [Meiothermus phage MMP7]
MAKPQPQLVNEPSSWARTDWAPADLTTAWRLAQGGNLSLAAELVDSILADDRIQATLGTRVRGLLGLPLTFEPANNREGK
SLVRALEADLWAFAPEESLYQLLAWGLLLGVGLARLDWQEGESGRLLPVLEVWHPRNLGYDPQRGAWYIQTREGSRVEPR
PGAWWLYTPYGSRRPWAQGLWRCLAVPWLVKTDAVRYWARDNEVGALRVGSASGPTTAEAREQLARDLAELGNSTGIALP
EGYQLQILSPSGEVWRSKEAAIGWANTALSTAILGQNLTTEVQGGSFAAARVHDAVRQDLLEADAEGLATSMREQVLAYW
AEFNYGDARLAPWPRWDTTQPEDRTQQAETLSKLAQAVATLTQAGAPVDVPALLEGYGVPLAAESTSSLVRLASGERVRA
SSGFVQGQLYADRLADNAREAGAVRLAPLVARVNQALEEAQDYEGLRERLLALFPEIKPDALAALMENALLLGELGGRYA
VWSDVES