TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B0C5P4|B0C5P4_ACAM1 Uncharacterized protein OS=Acaryochloris marina (strain MBIC 11017) GN=AM1_3778 PE=4 SV=1
MIFPEDPSRDELIRIVQLIIESKGTETELDQMLDWVETYSPHPNVSDLIFYPEDSDSLTAENIVDKIFQYRPIITSSFST
EAL