TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B0CIK0|B0CIK0_BRUSI Uncharacterized protein OS=Brucella suis (strain ATCC 23445 / NCTC 10510) OX=470137 GN=BSUIS_A0092 PE=3 SV=1
MADFRNIQAQQRPVGGARADAGIDQGLRSYMLGVYNMMAIGLAVTGLAAFGTAVLAQSNPAFQQLLFASPLRWVIMLAPL
AAVFFLSFRIQSLSVGTAQAIFWGYAALVGLSLSSIFIVFTGQSIVRTFFVTAASFGALSLYGYTTKRNLSAMGSFLMMG
LFGLILASVVNIFLGSTALQFAISVIGVLIFAGLTAYDTQEIKEMYYEGDAADTQGRKIVMGALRLYLDFINMFMFLLQF
MGNRE