TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B1KQV8|B1KQV8_SHEWM YfaZ family protein OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=Swoo_3446 PE=4 SV=1
MRLSLLSSLLILSSVSVTAFANDFSVGLNDDVISTDLAIDLNKNTNAVFGYIYSNDGGHLTSAAMHISHDAGIHHFEVGA
KFSYVWAKQSANGSAVGVGGRYKMDLGSSLSFHASGYYAPSVLSFGSVDGQYELDSKMQFQLNPSLALFAGYRNIRFQYD
YADNSTFDSGFYIGARARF