TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B1L790|B1L790_KORCO Membrane protein-like protein OS=Korarchaeum cryptofilum (strain OPF8) GN=Kcr_1574 PE=4 SV=1
MDLSSILFPPGSIIFLTFLALAISLGVNLINKRTINYERMRELQKIVKEYTDLQRELIKNPDDKRLKKKLDKMKPQFDAA
RAEMSRMNMRPLLYTTIPIIVIFWLLGNFYADIPVINLPFPLPWILDYFHNNAGLSNQTLGYVGYYVMASFLFSAIFQRL
FGTTPSE