TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B2X7D9|B2X7D9_9RHAB Putative uncharacterized protein U5 OS=Wongabel virus GN=U5 PE=4 SV=1
MKNLSSSVGDGHIWLKIHFLTMGFSINFDPIINKFREFQTNINHNINEQLDKLKMVWINLGSHIKYWFIIIISILTILFI
LFLLIKITKLILNCKKIFSCCCNVCCKKRPKVDIRSKEKVKVFSILP