TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B2ZXL8|B2ZXL8_BOMMO Putative amino acid transporter OS=Bombyx mori GN=+nsd-2 PE=2 SV=1
MDSNGINEKGDRVNAGFDPSPENVNDLKAIDNEDGKKRNVAERPTWDNQIEFLMSCIATSVGLGNVWRFPFVAYQNGGGA
FLIPYIIVLLVIGKPMYFLETVLGQFSSGNCVKIWALSPAMTGTGYAQTLGAVYVLSYYVSIIALCLYYFGVSFNATLPW
TQCLPEWRNCVPSGQSANLTEIQGEAVSSAQLYFTETVLRQSDGIDDGIGIPIWDLTLCLLVSWLIIFVIVARGVKSSGK
AAYFLALFPYVVMFILLIRAVTLPGAGNGILFFITPQWSKILEVRVWYAAVTQVFFSLSVCSGTLIMFSSYNKFSQNVYR
DSMIVTTLDTFTSLISGITIFGVLGNLAYQLGYDDVGRVIGAGGTSLAFISYPDAIAQSPIVPQLFAVLFFLMMAVLGVG
SGVALLSTVNTVLLDAFPRVPTVYMSATTCTIGFLVGLIYVTPGGQYILELVDYYGGTFMRLFAAITETIGVFWIYGLEN
LCVDIEFMLNIKTSFYWRICWAIVTPVIMIVVFIYALITTEALLFGNVYVYPRGAYIAGSALQYAGMVLIPIFIALALWK
YRSGTFIETVKRSFLKKDTYGPREIQKREEWRAFRRDAKSERKLKRKNWFHHVLYSLIGGYRRKR