TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B3ERI9|B3ERI9_AMOA5 Uncharacterized protein OS=Amoebophilus asiaticus (strain 5a2) GN=Aasi_0425 PE=4 SV=1
MSYRSYICLIAFFLGWFNNLKAQEQEFLDDSTHDVHGLHTTFFLTPADLKYNISGFKPLSVNIEKIDRFTFKQKMAYKVQ
DLGNEGTATKSIFYTLPQAIGAHSGFYVYDAYFRNPSHQRYYDTKAPYTDGTVVFANYGSYSFEGCHARSFNKNWHLGAM
FETIMSDREYIPSKIPYDRQVITYPFTLFGHYKTDNERYQLLVSFYRKEHRNRDTGGIVGKDSKVDKWLEAKAIINNNLS
TADSVESGELRQQYYLYHQAVYAEPLQVYQEVMVRNTNNYFTTRTLNAKSKAFLAGNLLNKLDSIEDSTTMQTFSNEWGI
KGKINRIFYQYYTREKLIKLEKINLLPRTLAEYYLGLYTRINVRDNIDFIHLHGEYLQGDFYKIHTSYKGSILELSYDQV
KYRPSFLSLRYESVYRNWNKNFKPPVGRQLEGSCRIPLPGVLVKPYGRFVHIQSPIYFQHVDSAGTFSTLIEPHQEKEYA
HIITWGTNINISLLTYFHLDTEIASTQVGGPAANAFRIPKWYTNVRSYYAKTFYKGKSEIETGIECNWKSSYHADGYDPI
TQQFFRQDDFNVYSYPIIELFFNFRIKTFRGFLKVVHVNQGLLSKPGYFVTPFYPGQLRSIDLGFSWSLFN