TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B3S136|B3S136_TRIAD Putative uncharacterized protein OS=Trichoplax adhaerens GN=TRIADDRAFT_36216 PE=4 SV=1
MSFEKQETLIKLVILSIAVVLSFATRLFSVLRFESVIHEFDPYFNYRTTRFLAEEGFYSFHNWFDDRAWYPLGRIIGGTI
YPGLMVTSAFIYHVLNWFHITIEIRNVCVFFAPLFSSCTTLVTYGLTKELKDSKAGLVAAAMIAIVPGYISRSVAGSYDN
EGIAIFCMLFTYYMWIKAVKTGSVYWAAMCSLGYFYMVSSWGGYVFLINLIPIHVFVLMVTGRFSHRIYIAYSTMYCLGT
ILSMQISFVGFQPVQSSEHMAAFGVFGLCQIYAFVEYLRFRLSKDYFQILFKNLAILVLVIVGAVAIILGITGKIAPWTG
RFYSLLDPSYAKNNIPIIASVSEHQPTTWSSFYFDLQMHVFMFPAGLYFCFKHLTDANIFIIIYGVTSIYFAGVMVRLML
VLAPVCCILSGIGVSSILSAFMKNLETTRKDKRNKRQDTYPVKTEVAVSVIGMMTLFLITYTFHCTWVTSEAYSSPSIVL
AAKQYDGSKIIFDDFREAYYWLRENTPEDAKVMSWWDYGYQITAMANRTILVDNNTWNNTHISRVGQAMSSSEDKAYEIM
RELDVDYVLVWFGGLTGYASDDINKFLWMVRIGGSTEKGKHIKEEDYYTKTGEFRVDKEGSPILLNCLMYKMCYYRFGEM
YTEQGKPSGYDRVRNVEIGNKDFQLDVLEEAYTTEHWLVRIYKVKKLDNRGL