TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B3WJF3|B3WJF3_ECOLX Putative membrane protein OS=Escherichia coli B171 GN=EcB171_3349 PE=4 SV=1
MNVFSQTQRYKALFWLSLFHLLVITSSNYLVQLPVSIFGFHTTWGAFSFPFIFLATDLTVRIFGAPLARRIIFAVMIPAL
LISYVISSLFYMGSWQGFGALAHFNLFVARIATASFMAYALGQILDVHVFNRLRQSRRWWLAPTASTLFGNVSDTLAFFF
IAFWRSPDAFMAEHWMEIALVDYCFKVLISIVFFLPMYGVLLNMLLKRLADKSEINALQAS