TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B4DG83|B4DG83_HUMAN cDNA FLJ50136, highly similar to Induced myeloid leukemia cell differentiation protein Mcl-1 OS=Homo sapiens PE=2 SV=1
MEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQA
TGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISF
GAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR