TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B5Y5F5|B5Y5F5_PHATC Predicted protein OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATR_44128 PE=4 SV=1
MTSTVPDETIEAPTTTTTANLPASISKLPIVCLAHGMRHKANAYELKNWVALALTLDGRDKLTKILQYVARLLSWWFAGR
GRINQAQRFASLKNSLTTSRKAFRMGRSVIEFHRLRKMGILEALGYYLQQNLDRKPRDEPAGKCLDTGGYGKNQQSLVPL
LNGLAYRLQQKMATTFLLTEPKLPDTPLWALLGTALKTLGLMGFWAADNISFLIASGTFDNYRLGSRERLERRNRYARRA
SAVANRAYFGGAVAGLIVNVRGYLDQRQTTLHFLQQRREQTQTADEIDFTKKGLEKAREKHFDSFVALTKSVCDVLVFSN
NPGIDLWQQQIGHKMHEGFHCLFGLISASAVLYNNYPAAC