TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B6XHZ9|B6XHZ9_9ENTR Uncharacterized protein OS=Providencia alcalifaciens DSM 30120 GN=PROVALCAL_02986 PE=4 SV=1
MIPNIVIINISNWIGEIPVIYSDYYRNESYLSALYCKMAPFFSIPYYLIVWNSIEIKKEHFKLYNKGIVTTIFGYFSIIL
IAFIITYINYFLNYNMSNGNINLRSISVFEFTSFLYYYAIFISVFTITCATVNAFLFLPIKYKKLNTD