TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B8AFH9|B8AFH9_ORYSI Putative uncharacterized protein OS=Oryza sativa subsp. indica GN=OsI_08104 PE=4 SV=1
MEGMWRKAKKALGAGLCVRVPAVAGDWEDGVSERRASDALSHDASSAAAAHVSAPNTPAAALPGAGPLRRSKSGTKSAKG
MCAICFDPMKSGHGQALFTAECSHMFHFHCISSSVKHGNYVCPVCRAKWKEIPFNRSLSSIVPRGRSGLNVNQARLPQQG
TYMALLRQVPSHHREASGSHTSEPVDFNDDEPLQLIESGDSRDARCSRVVEIKTYPEFSAIPQSSSEDDFAVLIHLKAPC
ANPEQVTGRPFNATSIGYPTSRAPVDLVTVLDVSGSMAGTKLALLKRAMGFVIQHLGPSDRLSVIAFSSTARRLFHLRRM
SHSGRQQALQAVNLLGAGGGTNIADALKKAAKVIEDRNYKNPVCSIILLSDGQDTYNISSNVRGTRPDYRSLVPSSILNH
TICTVPVHGFGFGADHDSDALHSIAESSGGTFSFIEDESVIQDAFAQCIGGLLSVVVQDMRLTVECVHPSVQLHTIKSGS
YLSKVAGDGRNGSIEVGHLYADEERDFLLSLSFPQSRDQTMLLKVACAYRDSVTNEAIKIHADEVKILRPKSPTSEPVCM
EVDRERNRVRAAEAIEAARAAAERGALSDAVAILEHCRRILSESFSRKSGDRLCISLDAELKEMQDRMASRQRYEASGRA
YLLSGLSSHSWQRATTRGDSTDSTTLVYSYQTPSMVQMLQRSQNQCPSPPGPRPQLRQTRSLLEKPHPR