TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B8D296|B8D296_HALOH Colicin V production protein OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=Hore_05660 PE=4 SV=1
MNQITILDILILVVFLYFVLRGYNNGFIKQTSTVVGLILALLIAIKFYQPFQKYLLPYLDFSDQIMQFISFSLLFVFVNI
IIQLLGRALKNIMNALFLGPVDQVAGAALGLLKAGILTYFLVLFLAQIPYQGITELLNRSVLAGSLLEMTPLVKQRLSQI
FGP