TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B8FDJ9|B8FDJ9_DESAA Uncharacterized protein OS=Desulfatibacillum alkenivorans (strain AK-01) GN=Dalk_4958 PE=4 SV=1
MKKLTTYSLVLALYAALAVLHTWPMALHMGEATPGSFNTIPTGGFMAEQAILFLQEHPFSLHKAFDPGLTAPLESPFLFL
GIPFGLSQIFGLFFLPTQNLHFAINGAMLFMLIGSAFSMFFLAQYLMQSARAGVVAGVVFSFTAATQCRTVDFIDMNMVI
VPWIVLFLFKYIHEDKSRHLYIAVGLLALQFYMYFYHCLFAVYLMAAIVIWRRKRFFTKEHIPAIAGAGFMGVLLILPLA
LPYLQTMVQYRLDQMTGSSESLFSYTFAYSPSEWFNAAKENLLYGAWLAQEYEAAGFPDFPHAALFPGVLVWYLVLTGAG
RMPRERISPWFLTGVLAFAVLASTGWKPLQFFRWEMSEALVLRHLSQILPLGSIIRNPTRLVVFYTFALALLTAGAFAGF
EQRILKAKGKAAAAILIAVVIAVITVENLSIPRPMYNFDALFGPSQSDFWLAENNPLTSPEESILHIPSKERLYQYDEGV
PPARLYVESNVGLYRHLWVRQTSANSHTSFLPRDFILPETRRLPSLEAQEYLYAQGVRLLVVHESLLYGKYKERFSRESM
AAQGFDLLASFDDGDAIYAMHPNICTANRLIILPVLENGRLEVLGLTPSLFDAMLKQEPVTPCFWLNPKTCRSQTMWATF
SDRNGKLRRKKYSYHLPLVVKGNARLIEDDLAADGLKGPFSMVSLEWNEPYLTPPPGVEYREQ