TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B8FV27|B8FV27_DESHD Uncharacterized protein OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) OX=272564 GN=Dhaf_0607 PE=4 SV=1
MTRREKAAQAVRVITVPPVMVLALLLFLFFQHKGVFTSAGELLLSVFFLSVIPLLAYPFSRLFPRCKAKGRDGQRNLAFI
LSLIGYAGAVLWGMIAGVSGELLFIFLVYLASVLILTFFNRVIGVRASGHASSITGPLLLTVYFIGGKTIIPCVLLLGAI
LWSSLTLKRHTLRELLLGAFSAMLAFFLCLIVICFRHSMGAVSKLVDSLLASPLLLV