TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B8ZYW2|B8ZYW2_HALMT Ammonium transporter protein OS=Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4) GN=amt1 PE=4 SV=1
MQPGFALLEAGQVRAKNVGNVLMKNMTDWALGVLVYFVVGAGVATIVGGLTSPGGFDVAAAFSYIGDSGAWIDWLFGAVF
AMTAATIVSGAVAERMDFRAYVVFAATITGFIYPVVQGLTWSGGLLSGSGYLGAALGVGYLDFAGATVVHMCGGVAGLVG
AKMVGPRKGRFGASGESQPIPGHSMLLAVLGTLILAFGWYGFNVGTQATVLATTESGGLEFMGAALGRVALVTTLGMGAG
AVAAMVVSTNYQGKPDPLWMANGLLAGLVAVTGAVPHVTWWGGLVLGALGGAIVLPAYRWTVDSLKIDDVCGVFAVHGVA
GAVGTALIPVFAVGGFSATQLVMQVAGVGIIALWTIVASAVVFAAAGTVFGLRVSEEEELEGLDIGEHGVSVYPEFIGES
GPDRGVGTRAATDGGNDVRTDGGNDVRTDGGNDVRTDGDVVGDNGVAVTEGNDSAAVDGGENQ