TCDB is operated by the Saier Lab Bioinformatics Group
>sp|B8ZZ34|SHSA8_HUMAN Putative protein shisa-8 OS=Homo sapiens GN=SHISA8 PE=5 SV=2
MARAGARGLLGGRRPPGLRLALALRLALLLARPPSGRAGAPEAQGPAAPGTTAPEGGDRCRGYYDVMGQWDPPFNCSSGA
YSFCCGTCGYRFCCHDGPRRLDQSRCSNYDTPAWVQTGRPPARARDTAAPRDPGRERSHTAVYAVCGVAALLVLAGIGAR
LGLERAHSPRARRTVTRALTELLKQPGPQEPLPPTLGPPLGGCVQVQMGDGLPRGSPHNSAGPRTPRLARASPPGEPFMR
VAPPGLAAAAAARDSEPGPVPGAGGCGEDRLGSQPRPENGPPGSHRTASGRGLRRGDSEGGVNRGIGPSRVSLLAPDKKR
LNNAPRGSAAPGPPRGPRLQGGGSLTLQPDYAKYATFKAAALKAAEAAPRDFCQRFPALEPSPRQPPARAPRPSPDLPAP
LDACPWAPPVYAPPAAPGPYAAWTSSRPARPAPLSHPTARAFQVPRRPGHAARRQFSVKMPETFNPQLPGLYGSAGRGSR
YLRTNSKTEVTV