TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B9D0I1|B9D0I1_WOLRE Major outer membrane protein OS=Campylobacter rectus RM3267 GN=CAMRE0001_1185 PE=4 SV=1
MKLAKISLAALVALGAFSTLNATPLEEAIKDVDFSGFARYRYTGNKLNVNDKKETKANHNFRFVGTFKAALDDNFFGVLG
LRYAASDGSGYNNDFTNTTSSFGVREFYLGYKAGNTTVTAGKQFAGTYFEGDLVATGLRVQNTDVSGLTLVGVAFDALET
DKIDYDGKLLSGVAGSRTLNYYGLGAMGSYDPVNFKAWWAYLEDTANLFAADVALKFDFDAVKLGLQGQYVHNESKDDDN
YGDANFFATKGNVGFFGVNLNAGYIHYKAKENKLSFVTVEDNGKLINPAKLLNSVMNGSAQYYNNIKDKNDYWFIGAAYK
FDKFGLFANYIDGKGYSWARKKRIDRDEWNIGGNYAYSKKLNFSTFYAATKEKDGDYKNKHDRIRFEAKYSF